​[BANGTAN BOMB] ​'​Anpanman' Special Stage (BTS focus) @​BTS COMEBACK SHOW - BTS (방탄소년단)

  Рет қаралды 8,443,522

BANGTANTV

7 жыл бұрын

BTS Official Homepage bts.ibighit.com
BTS Blog btsblog.ibighit.com
BTS Facebook bangtan.official

Пікірлер: 15 604
@goldensugakookie2987
@goldensugakookie2987 7 жыл бұрын
Jungkook flapping Taehyungs shirt so hard in the beginning is so adorable
@otaku22nyan28
@otaku22nyan28 7 жыл бұрын
How do your comments come up to the top without even any likes and mine always lost in the sea of comments? Curious...
@soyaasam
@soyaasam 7 жыл бұрын
i thought you said fappi-
@goldensugakookie2987
@goldensugakookie2987 7 жыл бұрын
Otaku 22Nyan// really? I didn’t even know that
@xiaoyang7368
@xiaoyang7368 7 жыл бұрын
Golden Sugakookie Do you ship taekook too?
@gixy-g6w
@gixy-g6w 7 жыл бұрын
😂
@to-tr5eo
@to-tr5eo 7 жыл бұрын
0:05 *The best special effects, eVER.*
@soliechamp
@soliechamp 7 жыл бұрын
πto MEGA AGREE
@allenciafernandes
@allenciafernandes 7 жыл бұрын
πto 🙊ikr
@ResaChiic
@ResaChiic 7 жыл бұрын
i cant believe they specifically zoomed in on the side *just* for that
@12myea
@12myea 7 жыл бұрын
10/10 would hire for special effects
@Yanni96PL
@Yanni96PL 7 жыл бұрын
stream fake love
@Dani_727
@Dani_727 7 жыл бұрын
Jungkook moving tae's shirt in the beginning is so adorable😭❤
@yiu7834
@yiu7834 7 жыл бұрын
kookieluver 101 you literally copied the comment below you
@heku899
@heku899 7 жыл бұрын
xPsychoNekox :3 XD
@sayyidhaidir7770
@sayyidhaidir7770 6 жыл бұрын
kookieluver 101
@kankykabrera1370
@kankykabrera1370 6 жыл бұрын
HOLA COMOESTAN
@kankykabrera1370
@kankykabrera1370 6 жыл бұрын
SON LINDO Y GRACIOSO
@lenanana8
@lenanana8 4 жыл бұрын
0:28 Jin's jump We need to talk about this more!
@mrdayy6527
@mrdayy6527 3 жыл бұрын
Yeahh my boy is soo cool 😎
@neverwalkalonesj5038
@neverwalkalonesj5038 2 жыл бұрын
Yeah, I love it
@danielaoliveira-dt8gn
@danielaoliveira-dt8gn Жыл бұрын
​@@neverwalkalonesj5038oi
@mlynlim5337
@mlynlim5337 6 ай бұрын
Yeah. It’s not easy
@aneesah8022
@aneesah8022 7 жыл бұрын
0:06 Jungkook: *vigorously ruffles Tae’s shirt*
@zaccaih
@zaccaih 7 жыл бұрын
Aneesah Ikram I was about to comment that...oh well
@mikasaarmy8964
@mikasaarmy8964 7 жыл бұрын
Aneesah Ikram so cute anpanman
@nikkomelette
@nikkomelette 7 жыл бұрын
ѕαмє ℓσℓ
@xxspacepotatoexx1013
@xxspacepotatoexx1013 7 жыл бұрын
Aneesah Ikram Oh ShAt I tHoUgHt It WaS wInD...
@armeme8101
@armeme8101 7 жыл бұрын
😂😂😂
@scarlethsoler.8231
@scarlethsoler.8231 7 жыл бұрын
-- *i'm dead this is the cutest thing in the world*
@somlvsfk
@somlvsfk 7 жыл бұрын
Dissociate. Chan No si la que habla dos idiomas
@btsa.r.m.ylittlemixmixer4233
@btsa.r.m.ylittlemixmixer4233 7 жыл бұрын
Alisson Pamela Avila 😂😂😂😂😂 dijo que se murió porque esto es la cosa más tierna que a visto en su vida
@cursedcockroachwithcatears3653
@cursedcockroachwithcatears3653 4 жыл бұрын
Ikr
@ang1296
@ang1296 7 жыл бұрын
i love how they show jungkook doing the little effect in the beginning uwu
@avanijoshi555
@avanijoshi555 7 жыл бұрын
I WAS WONDERING HOW TAE GOT HIS FLYING EFFECT WITH THERE BEING NO FANS AROUND WHATSOEVER! but lol it was kookie all along
@era1345
@era1345 7 жыл бұрын
정국이 열일하네🤣🤣🤣
@isabelle1250
@isabelle1250 4 жыл бұрын
anyone gonna talk about how professionally yoongi and jin handled the accidental trip? 0:50 edit: thanks for all the likes!!! i’ve noticed people saying that its on purpose but clearly yoongi’s ankle twisted in a weird way, and ofc the fake fall is in the choreo but i dont think yoongi and jin were supposed to physically bump into each other. nonetheless even if it weren’t in the choreo yoongi and jin handled it very professionally.
@Pokefan-qx7iy
@Pokefan-qx7iy 4 жыл бұрын
Oh yeah
@carolinekruk9080
@carolinekruk9080 4 жыл бұрын
i always assumed it was on purpose lol
@noneofyourbusiness74
@noneofyourbusiness74 4 жыл бұрын
It was on purpose
@noneofyourbusiness74
@noneofyourbusiness74 4 жыл бұрын
@@carolinekruk9080 it was
@LoveMusicSoul1
@LoveMusicSoul1 4 жыл бұрын
None Of your business This definitely seemed like an accident, Yoongi’s ankle turned a weird way. In the dance they’re supposed to fake trip but I don’t think that yoongi was actually supposed to trip like that. They’re just such stars that you don’t even notice the subtle mistakes
@valeriacarazamartinez8787
@valeriacarazamartinez8787 7 жыл бұрын
*0:50** Yoongi and Jin look at their feet...that was super professional,everything looked so natural on stage*
@haechpop2048
@haechpop2048 7 жыл бұрын
0:07 *_❝ The devil works hard but Jeon Jungkook works harder ❞_*
@mccucrumbs8916
@mccucrumbs8916 7 жыл бұрын
koko's thighs no props needed when jeon jungkook is around😂
@elijahvera6086
@elijahvera6086 7 жыл бұрын
LOL
@suciwarda6939
@suciwarda6939 7 жыл бұрын
ikr 😂
@leilaniaperson1990
@leilaniaperson1990 7 жыл бұрын
koko's thighs lol
@cheonsamanggae9000
@cheonsamanggae9000 7 жыл бұрын
i know right HAHHAHAHA
@mariasantillan2237
@mariasantillan2237 7 жыл бұрын
0:29 Jin and Jungkook wowwwww, my boys kill it 🔥🔥
@gorgelicious24
@gorgelicious24 4 жыл бұрын
omg why is nobody talking about how cute hobi is? he is soooo adorale and looks so happy and lively! aww he is really enjoying this dance. jungkook is so cute on his bit near the end!!!!!
@glaciouscathy6501
@glaciouscathy6501 3 жыл бұрын
Gyyygyyuytyttcffchkfhjgvjjhvchjjxgjjgghhgfhjgdghhgfgghjjgfgjjjhgf. Hdyihsthjgdfhggjjhgggghjhhfghhjh❤️❤️❤️❤️❤️❤️❤️❤️❤️💔💔💔👰🏼‍♂️🥳😍🥰😎✌️✌️
@glaciouscathy6501
@glaciouscathy6501 3 жыл бұрын
Ddffgggfgffffddddddbbhffdfghhhgfffghjkhgffhjhgdddfgggghjjhfffgghhhgghhhhjkkgfghjhffhjjhgfghjjjgfghjj💔💔💔💔💔💔💔💔💔✌️
@AswiniAhir
@AswiniAhir 9 ай бұрын
Hbeeeddnsxx👌👌😉👀
@mominaaasim7867
@mominaaasim7867 7 жыл бұрын
0:05 jungkook's special effects😂😂😂😂I love him so much
@armyin_dahouz6363
@armyin_dahouz6363 7 жыл бұрын
Ice Cream vkook 😌
@armyin_dahouz6363
@armyin_dahouz6363 7 жыл бұрын
Chandra Lukinich same thing lol
@howdyfolks8443
@howdyfolks8443 7 жыл бұрын
Jin: What do you call a hero that makes puns? BTS: hyung- Jin: *AnPUNman* *windshield wiper laugh* BTS: just stop pls
@Botwhile
@Botwhile 5 жыл бұрын
nice one 😂😂😂
@samyukthas8186
@samyukthas8186 5 жыл бұрын
Stob it!
@namu7868
@namu7868 5 жыл бұрын
Noduduwud
@jiminsdimple947
@jiminsdimple947 5 жыл бұрын
I Love BTS 3000 **only jimin dies of laughter**
@ashleyyy4286
@ashleyyy4286 5 жыл бұрын
zxmphy gorl..
@nicolekhim
@nicolekhim 7 жыл бұрын
JINS DANCING DURING JUNGKOOKS DANCE PART OMG YESSSS SO AMAZING
@AxelMacopelli
@AxelMacopelli 3 жыл бұрын
It hasn't been said enough how impressively Yoongi and Jin played off that very real trip Kings of professionalism 🤴
@danielaoliveira-dt8gn
@danielaoliveira-dt8gn Жыл бұрын
?
@AxelMacopelli
@AxelMacopelli Жыл бұрын
​@danielaoliveira-dt8gn technically a fake trip is a part of the choreography, but Yoongi's ankle crumpled to one side when he accidentally stepped on Jin's foot. They played it off well
@AswiniAhir
@AswiniAhir 9 ай бұрын
Meoknoo
@InnocentOmalla-t5n
@InnocentOmalla-t5n 2 ай бұрын
2:14
@ليهيوري-ج7ب
@ليهيوري-ج7ب 7 жыл бұрын
Jin is such a good dancer❤️❤️❤️
@donutsandgamesanime2181
@donutsandgamesanime2181 7 жыл бұрын
Ikr
@raenydayy
@raenydayy 7 жыл бұрын
YAHHHH
@metholi6293
@metholi6293 7 жыл бұрын
لي هيوري اعرف
@chicapau1605
@chicapau1605 7 жыл бұрын
Yes he's 😍
@saumyaa2981
@saumyaa2981 7 жыл бұрын
Someone said: "he dance like a traffic police officer" Me: NAH YOU GOTTA BE KIDDING !!!!!!
@emilygallant
@emilygallant 5 жыл бұрын
3:30 hobi said "i let it rain; i clear it out"
@vi9180
@vi9180 4 жыл бұрын
YASSSSS CHIKON NUUDEL SWOUP
@aliyalove4518
@aliyalove4518 4 жыл бұрын
Omg I didn't even notice that
@skyheart6207
@skyheart6207 4 жыл бұрын
lmao I'm dying 🤣🤣🤣
@cursedcockroachwithcatears3653
@cursedcockroachwithcatears3653 4 жыл бұрын
I just noticed it tbh lol
@nane_rajakumari
@nane_rajakumari 4 жыл бұрын
Holy sprite! I never noticed lol
@TheJiaKei
@TheJiaKei 7 жыл бұрын
*The amount of details Hoseok put into his dance moves... you can clearly see the difference*
@aizensvank5981
@aizensvank5981 4 жыл бұрын
Anpanman will forever be one of my favorite concerts
@irenemadreembid7384
@irenemadreembid7384 4 жыл бұрын
the best performance was anpanman with army on speak yourself tour!
@iamjimin
@iamjimin 7 жыл бұрын
Jimin can do any concept. Cute, sad, angry, happy you name it. He can pull it all off with ease. Also Hobi's leg work is no joke. You guys are my anpanmen!
@featheanzatty5688
@featheanzatty5688 7 жыл бұрын
Jungkook at the beginning lol so cute 😂
@lolhai3253
@lolhai3253 7 жыл бұрын
Ik TAEKOOOKKK
@era1345
@era1345 7 жыл бұрын
Cute 0:05 2:52 his dance is my favorite♡♡
@jade.xox__
@jade.xox__ 7 жыл бұрын
*Hoseok:* 0:14 *Yoongi:* 0:34 *I just have to say this. Is it true that I feel like I'm the only who feels as if Hoseok's destroyed/killed his verse like the way he started it off was so powerful? And just a few second later Yoongi comes in with "I'm not a super hero". I don't know it's something about his verse that makes me melt inside and along wit Hoseok's. It just sounds so epic, upbeat, and fun!* I am so proud of our boys. They deserve all the love and support. 😍
@fayyfayyy
@fayyfayyy 7 жыл бұрын
Unknown User hmm
@Yanni96PL
@Yanni96PL 7 жыл бұрын
stream fake love please armys
@heliosxdaisy1658
@heliosxdaisy1658 7 жыл бұрын
i dont feel like jhope destroy his verse or anything. if you understand the lyrics from jhope and suga, they compliment each other. like jhope said; "i dont have supercar like batman, i cant be superhero but i want to jump like one. so all i can give you is anpan" anpan which is the weakest superhero in the world. and suga came in genuinely; "i'm not superhero" so it's connected in a good way. but yeah, their rap always sounds fun but it is sad and full of hope.
@sofiala5851
@sofiala5851 7 жыл бұрын
I think the use of 'destroyed' refers to Hobi killing or slaying his verse, like he did really well. The first time I read the comment I was confused because the word destroyed kind of implied that it was bad.
@Bubalishus
@Bubalishus 7 жыл бұрын
Unknown User of course they always kill it
@elstagersaurus
@elstagersaurus 4 жыл бұрын
0:27 so are we just gonna ignore Jin's cute heel click look how adorable
@mlynlim5337
@mlynlim5337 6 ай бұрын
I was really impressed
@mochiaki_
@mochiaki_ 5 жыл бұрын
*If it wasn't for this video, we wouldn't know that it was Jungkook who's doing that to Tae's sweater lmao*
@nadiacallista1749
@nadiacallista1749 5 жыл бұрын
Pdlslslsls A aaalaa Aalaa.aasksksakaksxpamwswmapampslalpalaappaaalalakalskskakamakq spamalamoqkawpmapwkpqpqqpqpqqlalaalalaalaa Alskswkkwwklwkwkakkakwsmskmskawkakdkdkfjhgakz,mxmxmcmccmcv jd,slka,sla,a,a,a,alala.ala.alaa,aa,alaa Alalwlawlallsksls,lllelwllwlwlwwl,wpw,wlwlwwlwllwlwwlwleldld,lewlwlwl,s w,s ws,sls,slwllw Q
@wurtn
@wurtn 4 жыл бұрын
@@nadiacallista1749 Aree you ok... u need a doctor?
@ShwetaSingh-yy1lj
@ShwetaSingh-yy1lj 4 жыл бұрын
@@wurtn Savage 😂😂
@nazneenaslam6003
@nazneenaslam6003 4 жыл бұрын
I knew it was jk from the beginning, when the performance started I couldn't see him but I saw tae's shirt flapping so I knew it was Jungkook flapping it.
@cursedcockroachwithcatears3653
@cursedcockroachwithcatears3653 4 жыл бұрын
Yes I ✨u n d e r s t a n d✨
@mirxxn
@mirxxn 7 жыл бұрын
*Wow, Jin's dance is so good :0♥*
@mlynlim5337
@mlynlim5337 6 ай бұрын
Fr
@ElizabethConn-q3c
@ElizabethConn-q3c 7 жыл бұрын
DANG JIN’S DANCE JUST KEEPS GETTING BETTER
@トヨ神功
@トヨ神功 2 жыл бұрын
このアンパンマンを今見ると…素直に泣けちゃいます⤴︎⤴︎⤴︎⤴︎ 皆のヒーロー「BTS」いつまでも、みんなのヒーローでいてください。 最強最高のヒーローでなくていいんです。 身近なやさしい勇気をくれるアンパンマンで!! そろそろ、BTSのアンパンの欠片がほしいです💗
@peachsoup3695
@peachsoup3695 7 жыл бұрын
2:54 jin at it agAIN GET IT MY BOIII MAIN DANCERRRRRR
@SetMeFree9
@SetMeFree9 7 жыл бұрын
I really love Anpanman stages. They have so much fun dancing on the stage and looks really happy. I just love it!
@DoctorYizzle
@DoctorYizzle 7 жыл бұрын
hello army!!! i am a 19 year old korean rapper trying to make you guys happy as much as BTS does with their music. i just dropped a new music video! hopefully you can check it out and thank you so much for reading!!!!!!!!
@vkookbts8530
@vkookbts8530 7 жыл бұрын
0:05 _ 0:15 JUNGKOOK 😂😂 OMG LAUGH SO HARD 😅😅😅😅😅😅😅😅😅😅😅
@emianasayshi9058
@emianasayshi9058 7 жыл бұрын
Vkook BTS Same lmao 🤣🤣🤣🤣
@jazzymarshlew
@jazzymarshlew 7 жыл бұрын
Vkook BTS SAME 🤣🤣🤣🤣🤣
@wispycloud7184
@wispycloud7184 7 жыл бұрын
Same i woke my mom up (im in trouble lol)
@piepie8976
@piepie8976 7 жыл бұрын
Jungkook's face is so intense while doing it too XD
@Redkattz
@Redkattz 7 жыл бұрын
Vkook BTS SPECIAL EFFECTS MAN 😂
@dayane5631
@dayane5631 4 жыл бұрын
Anpanman💗💗💗💗💗💗💗💗
@ashburrrito
@ashburrrito 7 жыл бұрын
Every time Park Jimin smiled during this performance, my lifespan increased by 2 years.
@VSRides
@VSRides 7 жыл бұрын
Ashmita Nandy hahahaha
@nat-ep9vm
@nat-ep9vm 7 жыл бұрын
Welp I guess we're immortal now :D
@ashburrrito
@ashburrrito 7 жыл бұрын
• Natalie • The miraculous medical benefits of Park Jimin! 😂
@renn0913
@renn0913 7 жыл бұрын
Ashmita Nandy lol xD
@nya5629
@nya5629 7 жыл бұрын
yoo, whenever he smiled, my lifespan decreased to the point where now i'm fuckING dEAD. hE'S SO AMAZINGGGSGJDhgkfdsgh
@jungkooksbeautifulvoice7326
@jungkooksbeautifulvoice7326 7 жыл бұрын
JUNGKOOK IS SO CUTE OMG
@n_idontknow
@n_idontknow 7 жыл бұрын
Yesssss
@era1345
@era1345 7 жыл бұрын
0:05 1:50 2:52 cute and fuuny😍😍😍
@baekhyunsdaughter-in-law1861
@baekhyunsdaughter-in-law1861 7 жыл бұрын
I saw you everywhere 👏👏
@thaomydo84
@thaomydo84 7 жыл бұрын
Baekhyun, Seulgi & Jungkook phi Kon pppppppppppp0pppppppp
@jeoncindy2601
@jeoncindy2601 7 жыл бұрын
Baekhyun, Seulgi & Jungkook i agree with u
@SlaveOfAllahSwt1908
@SlaveOfAllahSwt1908 7 жыл бұрын
Omg The way Namjoon gave Jimin his “Power” at 2:09was so CUTE ❤️❤️☺️
@xim3gix990
@xim3gix990 4 жыл бұрын
1. Taes “waiting for ya Anpanman” (also, Tae overall) 😍 2. The swag on JK! His clothes, his voice! 3. How Suga plays off tripping on Jins shoe (0:49) so well! He also nailed the dance for not being part of the “dance line” 4. Jimins growl. Jimins voice! He also looks so cute throughout this whole video 5. JHope is so loose in this dance! He owns it (they all do but he stands out) 6. Jin is rocking that black and orange so well! And his voice is amazing. He also nailed the dance (same as Suga) 7. RM leadership in his rap at 1:52. How the music quietens down, *salute* RM! Also rocking the full orange! He also nailed the dance (same as Suga) Overall this video is amazing! The visuals between their individual styles plus the staging in the background 😍 I love this song so much!
@lovelyangel1964
@lovelyangel1964 7 жыл бұрын
Since no one states the obvious. The Hyung line: Jin, Hobi, Suga and RM gave this song life.
@mlynlim5337
@mlynlim5337 6 ай бұрын
Fr
@OUR_DAYS_ARE_GOLDEN
@OUR_DAYS_ARE_GOLDEN 7 жыл бұрын
KIM NAMJOON KIM SEOKJIN MIN YOONGI JUNG HOSEOK PARK JIMIN KIM TAEHYUNG JEON JUNGKOOK BTS🎖🎖🎊🎉🎊🎉🎊
@infinitybts1830
@infinitybts1830 7 жыл бұрын
0:06 such an effort jungkook..😂😂😂
@niyatimurarka766
@niyatimurarka766 5 жыл бұрын
Hahaha...he is so cute lol
@바다-n1e
@바다-n1e 4 жыл бұрын
💜 ⏩⏩
@snyaaaa.12
@snyaaaa.12 4 жыл бұрын
Before I watched this video I watched the other one and poor me I thought there would be some type of fan or something but it was jungkook 🤣🤣🤣🤣
@harukavideomaker429
@harukavideomaker429 4 жыл бұрын
The funniest and cutest i saw it for today my favorit video for today 🤣🥺💖
@AswiniAhir
@AswiniAhir 9 ай бұрын
Mypttdvc🛏️🥃😉
@seven-heaven0613
@seven-heaven0613 3 жыл бұрын
와 입덕한지 얼마안되서 몇개월동안 맨날 얘네 노래만 듣는데 들어도 들어도 다 새로운게 계속나옴ㅋㅋㅋ무슨 9년차아이돌이 20년된 신화보다 많은듯..어휴..근데 또 다좋아요ㅜㅜ
@eliwithluv
@eliwithluv 7 жыл бұрын
Seokjin and namjoon slay this choreo omg
@sophiacastillo4796
@sophiacastillo4796 7 жыл бұрын
fromispjm hi can you watch my videos on my youtube channel and if u enjoy don't forget to subscribe😊
@aiai7410
@aiai7410 7 жыл бұрын
Jin is so cute and handsome as usual)
@rebeca-sh3yp
@rebeca-sh3yp 7 жыл бұрын
this is one of the best choreographies and they are so sinchronyzed especially on this presentation, they must've trained really hard for this one, like always congrats boys, your efforts paid off, I hope you feel that way too and are satisfied with yourselves
@tashahaseena1200
@tashahaseena1200 4 жыл бұрын
Let see how many people coming in 2021??💜 JUST ME????🤔
@anismolbaby4367
@anismolbaby4367 4 жыл бұрын
Me
@cursedcockroachwithcatears3653
@cursedcockroachwithcatears3653 4 жыл бұрын
H e l l o
@Cristobels-Green-Boots
@Cristobels-Green-Boots Жыл бұрын
‘24 - & loving it! 🫠
@ame_carballo
@ame_carballo Жыл бұрын
Hola en 2024 😊
@sotaesty2
@sotaesty2 7 жыл бұрын
This choreography gets better every time I watch it-- they worked so hard during this comeback it's amazing
@cl03cl
@cl03cl 7 жыл бұрын
사랑keilana right
@mehmey
@mehmey 7 жыл бұрын
i agree. i’m exhausted just watching them. never a dull moment. our boys always aiming for above and beyond!
@ElusiveLion741
@ElusiveLion741 7 жыл бұрын
Ikr
@elizabethschrader1600
@elizabethschrader1600 7 жыл бұрын
Honestly my fav choreo of all their songs, it’s just so full of life.
@stargirl7646
@stargirl7646 7 жыл бұрын
Same! I keep wanting to learn it but I get lost about two seconds in haha
@GuCCiTaee
@GuCCiTaee 7 жыл бұрын
Their dancing got better especially Jin and RM I’m so proud❤️
@Isitjustrach
@Isitjustrach 7 жыл бұрын
GuCCiTae _ and yoongi
@lucianafernandez6261
@lucianafernandez6261 7 жыл бұрын
GuCCiTae _ 💙💗💚💛💜💟❣️💌💞💟❣️💌💚💛💜💝💌💟💞💚💙💗❣️💚💟💟💛❣️
@rhiannonedwards9870
@rhiannonedwards9870 7 жыл бұрын
*WAITING FOR YOU ANPANMAN*
@엄마나떵마려
@엄마나떵마려 2 жыл бұрын
우리 기숙사는 아니고 우리 학년 남자 기숙사에서 한 사감쌤이 매일 같은 곡 틀어주시는데 기상 점호 끝나고 기숙사로 돌아가는 길에 들리는 앙팡맨… 들릴 때마다 흥얼흥얼 거리면서 돌아가지ㅠㅠㅠ
@btsarethecauseofmyeuphoria8174
@btsarethecauseofmyeuphoria8174 7 жыл бұрын
Let's talk about J-Hope😍Damn he's super Handsome💕
@sunshine70
@sunshine70 5 жыл бұрын
Yes and his moves and flexibility I just love this man😊
@x_lindseyharder_x8949
@x_lindseyharder_x8949 5 жыл бұрын
Yeah he always is
@mohammadrezaullah6088
@mohammadrezaullah6088 4 жыл бұрын
Please do not use emogi bts is army
@taerahbasalo
@taerahbasalo 4 жыл бұрын
I AGREE 1000000000000000% 💜
@aliyalove4518
@aliyalove4518 4 жыл бұрын
@@mohammadrezaullah6088 Emojis don't freeze views and this is not even a music video. lmao Army's CAN use emojis
@kathrynbailey375
@kathrynbailey375 6 жыл бұрын
1:40 jhope is so bouncy and loose. it’s beautiful perfection
@Z01-k2s
@Z01-k2s 7 жыл бұрын
Can we appreciate RM and Jin efforts because they have improved so much l'm so proud of them ❤
@oyaoyaoya9099
@oyaoyaoya9099 7 жыл бұрын
Z 01 yes we should 😍😍😍😍
@_.itx_lily7._917
@_.itx_lily7._917 3 жыл бұрын
0:40 Suga And Jin Handle It So Well, I thought It Was On Purpose 0:29 Jin And Jk Jump Was Awesome 2:12 Jimin Voice ufff And 0:12 V Voice Saying Anpanman Is Appreciable 0:06 Jk Efforts Are Adorable Whole Song Is Masterpiece 💜
@danielaoliveira-dt8gn
@danielaoliveira-dt8gn Жыл бұрын
não é 0:53 eu tenho quê corrigir o minutos aqui em outro video tb do bts aqui no canal oficial para os outros fãs vê tb 😂😂 KKK aff foi mal kkk 😂😂😂
@africanarmy796
@africanarmy796 7 жыл бұрын
Jin has gotten really good at dancing. It gives me hope that maybe, just maybe, I too could one day dance well
@jessica-yx3xg
@jessica-yx3xg 5 жыл бұрын
Hi Connie👋🏼
@lucilatavernini1647
@lucilatavernini1647 5 жыл бұрын
Both Jin and RM can dance, why couldn't I?
@madamepumpkin
@madamepumpkin 5 жыл бұрын
How are you doing fellow dence beginner?
@1Jjozz
@1Jjozz 7 жыл бұрын
Jin is killing this choreo! So proud of him!!
@jshsk3425
@jshsk3425 7 жыл бұрын
0:41 jin is so cute ♡♡
@ranroon273
@ranroon273 6 жыл бұрын
😂😂 That was REALLY cute!!
@marielapainepe7861
@marielapainepe7861 6 жыл бұрын
Jin is so cute♥♥
@marielapainepe7861
@marielapainepe7861 5 жыл бұрын
Copion
@tanishkas4241
@tanishkas4241 5 жыл бұрын
Omgg....that was so adorable 💜💜💜
@Prxtty_Kpop
@Prxtty_Kpop 2 жыл бұрын
Jungkook flapping taehyung’s shirt to help him like a superhero is the cutest thing ever. He’s just the cutest 💜🥰
@maribelramos9517
@maribelramos9517 2 жыл бұрын
Yesssss!!!
@hm.99
@hm.99 7 жыл бұрын
I'm the only one who think, that Yoongi can dance better ? I'm so proud of him 👏🏻
@jiminhasjamsanditstrue5394
@jiminhasjamsanditstrue5394 7 жыл бұрын
Suga Saprin they all dance good 😑
@HUARIEE
@HUARIEE 7 жыл бұрын
JIMIN HAS JAMS AND ITS TRUE i think she meant That he has improved
@jiminhasjamsanditstrue5394
@jiminhasjamsanditstrue5394 7 жыл бұрын
Rice fields yoongi was a god in dancing already
@vtecgarcia1956
@vtecgarcia1956 7 жыл бұрын
Suga Saprin not better cuz that's rude to the other members but dances awesome
@tania2387
@tania2387 7 жыл бұрын
yoongi could always dance perfect he's just so underrated in the dance category
@shradhaharit9830
@shradhaharit9830 7 жыл бұрын
I'm so happy and proud of Jin. He has improved sooooooo much in everything. He dances sooo good to this song. And the outfit 😭😍😍😍💜💜💜💜
@deosnelytorreyes9370
@deosnelytorreyes9370 7 жыл бұрын
JIN´s dance is really good. Evolucion!
@blarmy827
@blarmy827 Жыл бұрын
Curly koo absolutely dominated this stage and choreo!!! His powerful dancing and smooth transitions are insane… even in the beginning he has those smooth parts with tae and joon and then tae goes away and JK spins backwards drops down to his knees and then has to do a high leap feet kick from the ground… that’s a difficult sequence and he handles it with ease.
@KIM.REVIEW
@KIM.REVIEW 7 жыл бұрын
bangtangman😎
@jinseulpark5618
@jinseulpark5618 7 жыл бұрын
Nayeli Gio Min Blass YEAH😂.
@jinseulpark5618
@jinseulpark5618 7 жыл бұрын
인터월드 interworld Yesss ahaha.
@햄복짜
@햄복짜 6 жыл бұрын
ㅋㅋㅋㅋ 방탄맨 ㅋㅋㅋ
@KIM.REVIEW
@KIM.REVIEW 6 жыл бұрын
방탄만 ㅋㅋㅋ
@vcookie718
@vcookie718 7 жыл бұрын
*Anpanman behind the scenes:cuteness overloaded.* 💕💕💕😍😍😍
@btsjungkookie4146
@btsjungkookie4146 7 жыл бұрын
V Cookie funk
@mikasaarmy8964
@mikasaarmy8964 7 жыл бұрын
0:51 look suga and jin so cute
@alexandrasilvestre2874
@alexandrasilvestre2874 2 жыл бұрын
Congratulations for the coreographer! Love the Way all singers move to all side.
@taehyungsnosefreckle5525
@taehyungsnosefreckle5525 7 жыл бұрын
I couldn’t keep my eyes off of Jin. His dancing has improved so much!
@reyn1288
@reyn1288 7 жыл бұрын
Exactly :)))))
@j3lby
@j3lby 6 жыл бұрын
2:49-3:09 It's super satisfying! Why is no one talking about it?
@ranroon273
@ranroon273 5 жыл бұрын
Cuz I thought it was enough to just keep replaying it 😂😂😉
@Maheenarmyandblink
@Maheenarmyandblink 5 жыл бұрын
Wow jungkooks part it’s always the best
@kvvaq4817
@kvvaq4817 5 жыл бұрын
haha it's a Chicken Noodel Soup
@greatestanika
@greatestanika 5 жыл бұрын
my most fav part of this song😍
@aliyalove4518
@aliyalove4518 4 жыл бұрын
I like 0:21 to 0:33
@ningchocoparfait
@ningchocoparfait 6 жыл бұрын
0:19, Jimin sliding away is so cute.
@mjl17
@mjl17 3 жыл бұрын
i love how i can focus on jin the whole performance bc on mnet’s version i couldnt 🥲 he is an amazing dancer so cute and fun to see
@Xx99-x7q
@Xx99-x7q 7 жыл бұрын
JIN DANCE IS THE BEST NOW
@yziaa-wdj
@yziaa-wdj 7 жыл бұрын
A.R.M. Y it’s true😏
@denisew.130
@denisew.130 7 жыл бұрын
A.R.M. Y Did you see him jumping???? Almost as flawless as Jungkook ♡
@zillaearl6031
@zillaearl6031 7 жыл бұрын
He has improved a lot
@loveyourself4703
@loveyourself4703 7 жыл бұрын
A.R.M. Y yup. 😊😊
@rachaelmin4234
@rachaelmin4234 7 жыл бұрын
decentia a ikr,I couldn't take my eyes off of him, he has improved alot 😊😊😊😊😊😊😊😊
@jayl.7364
@jayl.7364 7 жыл бұрын
Jin and Namjoonie both got so much better at dancing I’m so proud😭😍❤️
@yoonkimin1232
@yoonkimin1232 7 жыл бұрын
*junggoo working so hard doing that fanning thing uwu*
@dailydoseofsunshinee
@dailydoseofsunshinee 7 жыл бұрын
BTS Lounge 😂😂😂
@squilly7340
@squilly7340 7 жыл бұрын
BTS Lounge LMAOOOO
@kyliemarxen7537
@kyliemarxen7537 7 жыл бұрын
Seriously tho 😂 he was trying so hard
@Hlloyue
@Hlloyue 7 жыл бұрын
BTS Lounge lmao
@mursalsaid5448
@mursalsaid5448 4 жыл бұрын
My little brother (4 yo) loves jhope and then he saw jhope looking like a fireman he was sooo joyful because his bias looked his heroes
@vcookie718
@vcookie718 7 жыл бұрын
*Anpanman had already made us melt in their cuteness...and now this!!* 😂😂😍😍😍💕💕
@shradhaharit9830
@shradhaharit9830 7 жыл бұрын
Jinnie and joonie 💜💜💜😭😭😭😭💜😍😍💜💜 slaying those dance moves
@GuCCiTaee
@GuCCiTaee 7 жыл бұрын
Special effects works hard but jungkook works harder
@ronniepeony
@ronniepeony 2 жыл бұрын
My absolute favorite BTS song and version of it 🤩❤️
@selinakenttamaa9060
@selinakenttamaa9060 7 жыл бұрын
KILLING IT JIN!
@lili-tr5un
@lili-tr5un 7 жыл бұрын
Jin and NamJoon are improved so much 💜
@dawgucci5793
@dawgucci5793 7 жыл бұрын
0:05 Mr Jeon effects Jungkook activated
@lucianafernandez6261
@lucianafernandez6261 7 жыл бұрын
JIN Y NAHIARA bTS💋💘❤️💓💕💖👄💜💛💝💟❣️💗💞💌
@lucianafernandez6261
@lucianafernandez6261 7 жыл бұрын
💛💟💌💙💌💗💌💟❣️❣️❣️💙❣️💗💚💛💙💚💟💚💜💛💜💝💟💞💗❣️💚💛💌💜💜💗💙
@lohorst7948
@lohorst7948 4 жыл бұрын
Lol Jin and Jimin’s outfits are super similar so for a moment I was like “damn Jin is really graceful here!” But for real he did great in this!
@atiny6121
@atiny6121 7 жыл бұрын
JIMIN is The cutest and his bright smile Ahh 😍😍😍❤❤Sweet Mochi ❤❤❤
@rami9622
@rami9622 7 жыл бұрын
Abi-BTS ikr 😍😍
@janey6218
@janey6218 7 жыл бұрын
jimin😍😍😍
@rav3ngarde905
@rav3ngarde905 7 жыл бұрын
What I think happened: Big hit: We need someone to hold a fan behind V JK: I can do it Big hit: You sure? How are you gonna get rid of the fan? JK: Oh I got a better idea... *Flaps V's outfit like his life depends on it*
@teresaramos4054
@teresaramos4054 7 жыл бұрын
Rav3n Garde YESSS😂
@camilareyes8930
@camilareyes8930 7 жыл бұрын
Rav3n Garde no entendí pero like :v
@mirandarv17
@mirandarv17 7 жыл бұрын
Jin killed this dance he was so good
@kalaranibhaskar4534
@kalaranibhaskar4534 2 жыл бұрын
Yoongi and jhope stood out in this performance …😍😍
@annabellwetzel5412
@annabellwetzel5412 5 жыл бұрын
Why nobody talks about suga who slayed these dance moves? #lovesuga he did it so well, but of course the other members slayed too💎
@nanabibily
@nanabibily 4 жыл бұрын
Now I see this comment and I can't help but think about his shoulder injury, Suga seriously slayed this choreography 😔💜
@CindyLULZ
@CindyLULZ 3 жыл бұрын
Yeees! I went to the comment section to see if anyone also sees the same. He was in his element.
@armykookiehouse
@armykookiehouse 7 жыл бұрын
Repeated 2:55 so many times. Feeling like a proud mom. Our Seokjinnie has improved so much. 😀😀 Thank you BH for giving that part to Jin and Yoongi. They did it so well. 💜💜💜
@sandrahagar8258
@sandrahagar8258 7 жыл бұрын
my gosh Im almost tearing up, am such a weak B
@iseethatimicy9145
@iseethatimicy9145 6 жыл бұрын
I legit dead at that part
@lizbethbardaleschavez1783
@lizbethbardaleschavez1783 6 жыл бұрын
Me gusta tu video
@lizbethbardaleschavez1783
@lizbethbardaleschavez1783 6 жыл бұрын
Yo nopuedob ablar corean
@kimmybliss
@kimmybliss 7 жыл бұрын
2:55 look at those moves MY GOD, Who said that Jin can't dance? Look at my babe dancing with happiness❤❤
@Tamsaa-yr1fb
@Tamsaa-yr1fb 7 жыл бұрын
BTS- Tear got me on tears yesss😍😊 and yoongi ma biasss
@kimmybliss
@kimmybliss 7 жыл бұрын
Tämsää 0202 Mine too girl😏 Buuut, I love BTS because I keep changing biases so😂
@chiminh6953
@chiminh6953 7 жыл бұрын
😂😂😂
@yoonjinlife9579
@yoonjinlife9579 7 жыл бұрын
BTS- Tear got me on tears exactly me.. that's why I decided that they are all my bias 😆😘
@Tamsaa-yr1fb
@Tamsaa-yr1fb 7 жыл бұрын
BTS- Tear got me on tears me too😂 at first was jimin😍😅
@maneshchoudhary3125
@maneshchoudhary3125 4 жыл бұрын
Jungkook flapping Tae's shirt in beginning is too adorable. I PURPLE THEM ALL !! 💜💜
@a1124z1
@a1124z1 7 жыл бұрын
2:55 Suga and Jin's moves omg
@SIEGS
@SIEGS 7 жыл бұрын
I was about to mention it. I cant remember how many times I've watched it.
@imounak-popergirlforever9738
@imounak-popergirlforever9738 7 жыл бұрын
I love suga and jimin
@jeanne4162
@jeanne4162 7 жыл бұрын
My biases ➳
@doniashii7202
@doniashii7202 7 жыл бұрын
especially jin .. he did it as well 😍💜
@zeyu4129
@zeyu4129 7 жыл бұрын
your eaction suits your profile pic....hahaha
@aneesah8022
@aneesah8022 7 жыл бұрын
I’m still affected by Jimin’s deep voice 😍
@blanckuchis
@blanckuchis 7 жыл бұрын
Aneesah Ikram haha
@faeriekyuu
@faeriekyuu 7 жыл бұрын
trfhnhhfujibfkns don’t even go there i- 😍
@martineschwan1527
@martineschwan1527 7 жыл бұрын
Namyoonjin's dancing has improved immensely. They look like professionals 😍
@epicotakucherry5280
@epicotakucherry5280 7 жыл бұрын
Why have I never seen that combo of their names before? That's brilliant. I love it. And yes, I agree with you completely.
@rachelleb8238
@rachelleb8238 7 жыл бұрын
Martine Schwan they've always been professionals for me tbh😅 i look like a duck when im dancing 😂
@mlynlim5337
@mlynlim5337 6 ай бұрын
They are pros
@みかん-w7h
@みかん-w7h 3 жыл бұрын
最初の後ろのグク可愛んよwpあとこの曲好きすぎる🤦‍♀️
@tsuki7168
@tsuki7168 7 жыл бұрын
Suga you're doing amazing sweetie😍
@goldensugakookie2987
@goldensugakookie2987 7 жыл бұрын
BTS are my Anpanman
@crenzairacarreon9345
@crenzairacarreon9345 7 жыл бұрын
Golden Sugakookie THEY OUR ARE ANPANMAN
@sarah951srh
@sarah951srh 7 жыл бұрын
Golden Sugakookie yeahhhhh
@jinsface9875
@jinsface9875 7 жыл бұрын
Jin has grown so muchhhh.
@Star-yw8od
@Star-yw8od 4 жыл бұрын
but can we talk about ARMY for a second? you could hear BTS singing really clearly like they were in a movie because of how quiet and respectful ARMY were!
@SetMeFree9
@SetMeFree9 7 жыл бұрын
I'm addicted to this song! I probably listened to it more than 1000 times❤❤
@SuDoesThings
@SuDoesThings 7 жыл бұрын
Once * Army OMG hahahaha I saw you in the comment section of BlackPink Forever Young😂😂😂😂
@hemamrenidevi8981
@hemamrenidevi8981 7 жыл бұрын
Once * Army same
@majadg8895
@majadg8895 7 жыл бұрын
I love to listen to it esp in the morning.. the songs gives a lot of energy.
@ChristaTheRat
@ChristaTheRat 7 жыл бұрын
Once * Army mee tooooo
@unhinged6823
@unhinged6823 7 жыл бұрын
Same
@choileepark8974
@choileepark8974 7 жыл бұрын
My ANPANMAN IS BTS😄😄😃😃😊☺
@ysa_kim4143
@ysa_kim4143 7 жыл бұрын
Choi LeePark 😂😂😂😂😂
@choileepark8974
@choileepark8974 7 жыл бұрын
ŲMĄ ÇRY Ą.R.M.Y ;3 .. Why😅😅
@yasmink.6426
@yasmink.6426 7 жыл бұрын
OMG JIN IMPROVED SO MUCH!! SO PROUD OF HIM😍
@gwendolyncormier9026
@gwendolyncormier9026 Жыл бұрын
BTS is in the military, but we see them whenever we want online.
ИСПОРТИЛА КОМНАТУ СЕСТРЫ
00:44
Натали Макколи
Рет қаралды 1,9 МЛН
Выловили двухлетний арбуз из колодца..🫢🍉🪣
00:46
Adilet Jaygashar - Қара түн [Official Music video]
3:25
Adilet Jaygashar
Рет қаралды 177 М.
Өмір тәтті сенімен - Заттыбек Көпбосынұлы | NEW | Audio
3:28
Заттыбек Көпбосынұлы
Рет қаралды 71 М.
Mashhur Muhammad - Pul | Машхур Мухаммад - Пул
6:04
Сүйгім келеді
2:59
Айбек Қайбулла - Topic
Рет қаралды 628 М.